PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 213aa    MW: 23829.7 Da    PI: 10.2224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2488genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-183782147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd +l + v+++G+++W++I+r++  gR++k+c++rw + 
      Gh_D05G2488 37 KGPWSAEEDRILTRFVEKYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 82
                     79*****************************9.***********985 PP

2Myb_DNA-binding50.54.8e-1691133347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar +  gRt++ +k++w++ 
      Gh_D05G2488  91 PFSQAEDETILAAHARFGNR-WATIARLLH-GRTDNAVKNHWNST 133
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.483287IPR017930Myb domain
SuperFamilySSF466895.39E-3135130IPR009057Homeodomain-like
SMARTSM007177.4E-173685IPR001005SANT/Myb domain
PfamPF002491.2E-173782IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-243890IPR009057Homeodomain-like
CDDcd001671.35E-143981No hitNo description
SMARTSM007173.1E-1388136IPR001005SANT/Myb domain
PROSITE profilePS5129419.3389138IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2291137IPR009057Homeodomain-like
CDDcd001673.02E-991134No hitNo description
PfamPF002494.9E-1391133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MEAVNGCSSS SSCDTSSSSS SKSSLSAMAS SKSEKIKGPW SAEEDRILTR FVEKYGPRNW  60
SLISRYIKGR SGKSCRLRWC NQLSPNVEHR PFSQAEDETI LAAHARFGNR WATIARLLHG  120
RTDNAVKNHW NSTLKRKAKE SKQQQQRKEQ ISMSTYQQMD EEALSTSLTL APPGSGTASV  180
AERRISVPAE LWDVMRDVVA RQVREYMSSA SSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-42341381105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591568e-46AJ459156.1 Gossypium hirsutum partial myb127 gene, clone pGhMYB127.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440639.11e-154PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D2TSP61e-153A0A0D2TSP6_G
STRINGPOPTR_0002s13030.12e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145531122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-58myb domain protein 73